PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034298001
Common NameGSBRNA2T00034298001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 293aa    MW: 31687.5 Da    PI: 8.1159
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034298001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.9e-38258662
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  GSBRNA2T00034298001  2 VNCPRCNSINTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 58
                         79****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-23150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.323256IPR003851Zinc finger, Dof-type
PfamPF027012.0E-32256IPR003851Zinc finger, Dof-type
PROSITE patternPS013610440IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
AVNCPRCNSI NTKFCYYNNY SLTQPRFFCK GCRRYWTEGG SLRNIPVGGG SRKNKRSHSS  60
SVSSSSDINK NHSDSTQPAT KKHHSDHHHL MSMSQQGLTG QNPKFFETTQ QDLNLGFPPH  120
GLIRTNFTDL IHNIGNNNKS TNNPLLSSSS STTSAMAVSS LDLIRNNTSN NGSSSFMGFP  180
FHNQDPTSGG FSMQDHYKPC NSNTTLLGFS LDHHHNNGFH GGFQEGEGGG EAGDDVNGRH  240
LFPFEDLKLP VSSSSATINV DINDNQKRAS GGDASANSGG YWTGMLSGGS WC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.164561e-157flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3171530.0AK317153.1 Arabidopsis thaliana AT4G24060 mRNA, complete cds, clone: RAFL21-94-L04.
GenBankAL1096190.0AL109619.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T19F6, partial sequence (ESSA project).
GenBankAL1615600.0AL161560.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 60.
GenBankATAC0023430.0AC002343.1 Arabidopsis thaliana chromosome IV BAC T19F6 genomic sequence, complete sequence.
GenBankAY0372200.0AY037220.1 Arabidopsis thaliana AT4g24060/T19F6_50 mRNA, complete cds.
GenBankAY0876860.0AY087686.1 Arabidopsis thaliana clone 37663 mRNA, complete sequence.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137657.10.0PREDICTED: dof zinc finger protein DOF4.6
RefseqXP_013710275.10.0PREDICTED: dof zinc finger protein DOF4.6-like
SwissprotQ8LAP81e-155DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A078K4290.0A0A078K429_BRANA; BnaAnng41900D protein (Fragment)
TrEMBLM4DB980.0M4DB98_BRARP; Uncharacterized protein
STRINGBra013758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-108Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]